Lineage for d5fwrc_ (5fwr C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767438Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2767443Family b.2.3.2: Pilus subunits [49405] (11 proteins)
  6. 2767497Protein Mannose-specific adhesin FimH, N-terminal domain [418900] (2 species)
    protein duplication: consists of two domains of this fold; C-terminal domain lacks the last strand
  7. 2767561Species Escherichia coli [TaxId:83333] [419302] (26 PDB entries)
  8. 2767610Domain d5fwrc_: 5fwr C: [326684]
    automated match to d4csta_
    complexed with 3x8; mutant

Details for d5fwrc_

PDB Entry: 5fwr (more details), 2.13 Å

PDB Description: breaking down the wall: mutation of the tyrosine gate of the universal escherichia coli fimbrial adhesin fimh
PDB Compounds: (C:) FimH

SCOPe Domain Sequences for d5fwrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fwrc_ b.2.3.2 (C:) Mannose-specific adhesin FimH, N-terminal domain {Escherichia coli [TaxId: 83333]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

SCOPe Domain Coordinates for d5fwrc_:

Click to download the PDB-style file with coordinates for d5fwrc_.
(The format of our PDB-style files is described here.)

Timeline for d5fwrc_: