Lineage for d5gy7a_ (5gy7 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2090553Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 protein domains)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2091795Protein automated matches [190085] (51 species)
    not a true protein
  7. 2283377Species Escherichia coli [TaxId:83333] [326678] (1 PDB entry)
  8. 2283378Domain d5gy7a_: 5gy7 A: [326679]
    automated match to d1kvqa_
    complexed with gol, nad, no3, udp; mutant

Details for d5gy7a_

PDB Entry: 5gy7 (more details), 1.43 Å

PDB Description: x-ray structure of h243i mutant of udp-galactose 4-epimerase from e.coli:evidence for existence of open and closed active site during catalysis.
PDB Compounds: (A:) UDP-glucose 4-epimerase

SCOPe Domain Sequences for d5gy7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gy7a_ c.2.1.2 (A:) automated matches {Escherichia coli [TaxId: 83333]}
mrvlvtggsgyigshtcvqllqnghdviildnlcnskrsvlpvierlggkhptfvegdir
nealmteilhdhaidtvihfaglkavgesvqkpleyydnnvngtlrlisamraanvknfi
fsssatvygdqpkipyvesfptgtpqspygksklmveqiltdlqkaqpdwsiallryfnp
vgahpsgdmgedpqgipnnlmpyiaqvavgrrdslaifgndyptedgtgvrdyihvmdla
dgivvameklankpgvhiynlgagvgnsvldvvnafskacgkpvnyhfaprregdlpayw
adaskadrelnwrvtrtldemaqdtwhwqsrhpqgypd

SCOPe Domain Coordinates for d5gy7a_:

Click to download the PDB-style file with coordinates for d5gy7a_.
(The format of our PDB-style files is described here.)

Timeline for d5gy7a_:

  • d5gy7a_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-30