SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5exqa_ (5exq A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980368Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980369Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1980370Family a.3.1.1: monodomain cytochrome c [46627] (16 protein domains)
  6. 1980579Protein Mitochondrial cytochrome c [46642] (7 species)
  7. 1980710Species Human (Homo sapiens) [TaxId:9606] [109644] (8 PDB entries)
    Uniprot P99999
  8. 2283374Domain d5exqa_: 5exq A: [326675]
    automated match to d3zcfa_
    complexed with hem, so4

Details for d5exqa_

PDB Entry: 5exq (more details), 1.6 Å

PDB Description: human cytochrome c y48h
PDB Compounds: (A:) cytochrome c

SCOPe Domain Sequences for d5exqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5exqa_ a.3.1.1 (A:) Mitochondrial cytochrome c {Human (Homo sapiens) [TaxId: 9606]}
gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgyshtaanknkgiiwg
edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne

SCOPe Domain Coordinates for d5exqa_:

Click to download the PDB-style file with coordinates for d5exqa_.
(The format of our PDB-style files is described here.)

Timeline for d5exqa_:

  • d5exqa_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-30