SCOPe 2.06: Domain d5jf3a_: 5jf3 A:

Lineage for d5jf3a_ (5jf3 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
   automatically mapped to Pfam PF01327

6. Protein automated matches [190200] (9 species)
   not a true protein

7. Species Streptococcus agalactiae [TaxId:1311] [326636] (10 PDB entries)

8. Domain d5jf3a_: 5jf3 A: [326665]
   automated match to d3l87a_
   complexed with act, imd, sf5, zn

Details for d5jf3a_

PDB Entry: 5jf3, 1.6 Å

PDB Description: crystal structure of type 2 pdf from streptococcus agalactiae in complex with inhibitor at018

PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d5jf3a_:

Sequence; same for both SEQRES and ATOM records:

>d5jf3a_ d.167.1.1 (A:) automated matches {Streptococcus agalactiae [TaxId: 1311]}
aaidklvkashlidmndiiregnptlrkvaeevtfplsekeeilgekmmqflkhsqdpim
aeklglrggvglaapqldiskriiavlvpnvedaqgnppkeayslqevmynpkvvshsvq
daalsdgegclsvdrevpgyvvrharvtieyfdktgekhrlklkgynsivvqheidhidg
imfydrineknpfavkegllile

Timeline for d5jf3a_:

• d5jf3a_ is new in SCOPe 2.06-stable
  
• d5jf3a_ appears in SCOPe 2.07
  
• d5jf3a_ appears in the current release, SCOPe 2.08