SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jf3a_ (5jf3 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208465Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 2208466Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 2208467Family d.167.1.1: Peptide deformylase [56421] (2 protein domains)
    automatically mapped to Pfam PF01327
  6. 2208586Protein automated matches [190200] (9 species)
    not a true protein
  7. 2283335Species Streptococcus agalactiae [TaxId:1311] [326636] (10 PDB entries)
  8. 2283364Domain d5jf3a_: 5jf3 A: [326665]
    automated match to d3l87a_
    complexed with act, imd, sf5, zn

Details for d5jf3a_

PDB Entry: 5jf3 (more details), 1.6 Å

PDB Description: crystal structure of type 2 pdf from streptococcus agalactiae in complex with inhibitor at018
PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d5jf3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jf3a_ d.167.1.1 (A:) automated matches {Streptococcus agalactiae [TaxId: 1311]}
aaidklvkashlidmndiiregnptlrkvaeevtfplsekeeilgekmmqflkhsqdpim
aeklglrggvglaapqldiskriiavlvpnvedaqgnppkeayslqevmynpkvvshsvq
daalsdgegclsvdrevpgyvvrharvtieyfdktgekhrlklkgynsivvqheidhidg
imfydrineknpfavkegllile

SCOPe Domain Coordinates for d5jf3a_:

Click to download the PDB-style file with coordinates for d5jf3a_.
(The format of our PDB-style files is described here.)

Timeline for d5jf3a_:

  • d5jf3a_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-30