SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5itpb_ (5itp B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145531Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2145532Protein automated matches [190039] (134 species)
    not a true protein
  7. 2283358Species Agrobacterium fabrum [TaxId:358] [326659] (1 PDB entry)
  8. 2283359Domain d5itpb_: 5itp B: [326660]
    automated match to d4p0ib_
    complexed with 6db, edo, peg

Details for d5itpb_

PDB Entry: 5itp (more details), 1.85 Å

PDB Description: structure of the periplasmic binding protein noct from a.tumefaciens in complex with octopine
PDB Compounds: (B:) Nopaline-binding periplasmic protein

SCOPe Domain Sequences for d5itpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5itpb_ c.94.1.0 (B:) automated matches {Agrobacterium fabrum [TaxId: 358]}
yksitiategsyapynfkdaggkligfdidlgndlckrmnieckfveqawdgiipsltag
rydaimaamgiqparekviafsrpylltpmtflttadspllktqvaienlpldnitpeqk
aeldkftkifegvkfgvqagtsheafmkqmmpsvqistydtidnvvmdlkagridaslas
vsflkpltdkpdnkdlkmfgprmtgglfgkgvgvgirkedadlkalfdkaidaaiadgtv
qklsqqwfgydasp

SCOPe Domain Coordinates for d5itpb_:

Click to download the PDB-style file with coordinates for d5itpb_.
(The format of our PDB-style files is described here.)

Timeline for d5itpb_:

  • d5itpb_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-30