Lineage for d5j41a2 (5j41 A:77-209)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998814Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1998815Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1998816Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1999147Protein Class pi GST [81347] (4 species)
  7. 1999148Species Human (Homo sapiens) [TaxId:9606] [47619] (63 PDB entries)
  8. 1999151Domain d5j41a2: 5j41 A:77-209 [326650]
    Other proteins in same PDB: d5j41a1, d5j41b1
    automated match to d1aqwa1
    complexed with 3lf, gsh, mes

Details for d5j41a2

PDB Entry: 5j41 (more details), 1.19 Å

PDB Description: glutathione s-transferase bound with hydrolyzed piperlongumine
PDB Compounds: (A:) Glutathione S-transferase P

SCOPe Domain Sequences for d5j41a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j41a2 a.45.1.1 (A:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOPe Domain Coordinates for d5j41a2:

Click to download the PDB-style file with coordinates for d5j41a2.
(The format of our PDB-style files is described here.)

Timeline for d5j41a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5j41a1