SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5j41a2 (5j41 A:77-209)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996612Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1996613Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1996614Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 protein domains)
  6. 1996931Protein Class pi GST [81347] (4 species)
  7. 1996932Species Human (Homo sapiens) [TaxId:9606] [47619] (61 PDB entries)
  8. 2283349Domain d5j41a2: 5j41 A:77-209 [326650]
    Other proteins in same PDB: d5j41a1, d5j41b1
    automated match to d1aqwa1
    complexed with 3lf, gsh, mes

Details for d5j41a2

PDB Entry: 5j41 (more details), 1.19 Å

PDB Description: glutathione s-transferase bound with hydrolyzed piperlongumine
PDB Compounds: (A:) Glutathione S-transferase P

SCOPe Domain Sequences for d5j41a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j41a2 a.45.1.1 (A:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOPe Domain Coordinates for d5j41a2:

Click to download the PDB-style file with coordinates for d5j41a2.
(The format of our PDB-style files is described here.)

Timeline for d5j41a2:

  • d5j41a2 appears in periodic updates to SCOPe 2.06 starting on 2016-11-30

View in 3D
Domains from same chain:
(mouse over for more information)
d5j41a1