SCOP 1.65: Domain d1ptva_: 1ptv A:

Lineage for d1ptva_ (1ptv A:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1432

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (2 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (3 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein Tyrosine phosphatase [52806] (8 species)

7. Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (48 PDB entries)

8. Domain d1ptva_: 1ptv A: [32665]
   complexed with phs; mutant

Details for d1ptva_

PDB Entry: 1ptv, 2.3 Å

PDB Description: crystal structure of protein tyrosine phosphatase 1b complexed with phosphotyrosine

SCOP Domain Sequences for d1ptva_:

Sequence; same for both SEQRES and ATOM records:

>d1ptva_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), 1B}
emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
aqywpqkeekemifedtnlkltlisediktyytvrqlelenlttqetreilhfhyttwpd
fgvpespasflnflfkvresgslspehgpvvvhssagigrsgtfcladtclllmdkrkdp
ssvdikkvlldmrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshed

Timeline for d1ptva_:

• d1ptva_ first appeared (with stable ids) in SCOP 1.55
  
• d1ptva_ appears in SCOP 1.63
  
• d1ptva_ appears in SCOP 1.67
  
• d1ptva_ appears in the current release, SCOPe 2.08