SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5j41a1 (5j41 A:1-76)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2117361Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 protein domains)
  6. 2117676Protein Class pi GST [81358] (4 species)
  7. 2117677Species Human (Homo sapiens) [TaxId:9606] [52864] (57 PDB entries)
  8. 2283348Domain d5j41a1: 5j41 A:1-76 [326649]
    Other proteins in same PDB: d5j41a2, d5j41b2
    automated match to d1aqwa2
    complexed with 3lf, gsh, mes

Details for d5j41a1

PDB Entry: 5j41 (more details), 1.19 Å

PDB Description: glutathione s-transferase bound with hydrolyzed piperlongumine
PDB Compounds: (A:) Glutathione S-transferase P

SCOPe Domain Sequences for d5j41a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j41a1 c.47.1.5 (A:1-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
tlyqsntilrhlgrtl

SCOPe Domain Coordinates for d5j41a1:

Click to download the PDB-style file with coordinates for d5j41a1.
(The format of our PDB-style files is described here.)

Timeline for d5j41a1:

  • d5j41a1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-30

View in 3D
Domains from same chain:
(mouse over for more information)
d5j41a2