Lineage for d5j41a1 (5j41 A:1-76)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2117361Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 protein domains)
  6. 2117676Protein Class pi GST [81358] (4 species)
  7. 2117677Species Human (Homo sapiens) [TaxId:9606] [52864] (59 PDB entries)
  8. 2283348Domain d5j41a1: 5j41 A:1-76 [326649]
    Other proteins in same PDB: d5j41a2, d5j41b2
    automated match to d1aqwa2
    complexed with 3lf, gsh, mes

Details for d5j41a1

PDB Entry: 5j41 (more details), 1.19 Å

PDB Description: glutathione s-transferase bound with hydrolyzed piperlongumine
PDB Compounds: (A:) Glutathione S-transferase P

SCOPe Domain Sequences for d5j41a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j41a1 c.47.1.5 (A:1-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
tlyqsntilrhlgrtl

SCOPe Domain Coordinates for d5j41a1:

Click to download the PDB-style file with coordinates for d5j41a1.
(The format of our PDB-style files is described here.)

Timeline for d5j41a1:

  • d5j41a1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-30

View in 3D
Domains from same chain:
(mouse over for more information)
d5j41a2