Lineage for d5exqb_ (5exq B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980368Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980369Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1980370Family a.3.1.1: monodomain cytochrome c [46627] (16 protein domains)
  6. 1980579Protein Mitochondrial cytochrome c [46642] (7 species)
  7. 1980710Species Human (Homo sapiens) [TaxId:9606] [109644] (9 PDB entries)
    Uniprot P99999
  8. 2283347Domain d5exqb_: 5exq B: [326648]
    automated match to d3zcfa_
    complexed with hem, so4

Details for d5exqb_

PDB Entry: 5exq (more details), 1.6 Å

PDB Description: human cytochrome c y48h
PDB Compounds: (B:) cytochrome c

SCOPe Domain Sequences for d5exqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5exqb_ a.3.1.1 (B:) Mitochondrial cytochrome c {Human (Homo sapiens) [TaxId: 9606]}
gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgyshtaanknkgiiwg
edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne

SCOPe Domain Coordinates for d5exqb_:

Click to download the PDB-style file with coordinates for d5exqb_.
(The format of our PDB-style files is described here.)

Timeline for d5exqb_:

  • d5exqb_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-30