SCOPe 2.06: Domain d5itoa_: 5ito A:

Lineage for d5itoa_ (5ito A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (140 species)
   not a true protein

7. Species Agrobacterium tumefaciens [TaxId:176299] [260526] (9 PDB entries)

8. Domain d5itoa_: 5ito A: [326635]
   automated match to d4p0ib_
   complexed with 1pe, 6db, edo, peg, toe

Details for d5itoa_

PDB Entry: 5ito, 2.35 Å

PDB Description: structure of the periplasmic binding protein m117n-noct from a. tumefaciens in complex with octopine

PDB Compounds: (A:) Nopaline-binding periplasmic protein

SCOPe Domain Sequences for d5itoa_:

Sequence; same for both SEQRES and ATOM records:

>d5itoa_ c.94.1.0 (A:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
dyksitiategsyapynfkdaggkligfdidlgndlckrmnieckfveqawdgiipslta
grydaimaamgiqparekviafsrpylltpntflttadspllktqvaienlpldnitpeq
kaeldkftkifegvkfgvqagtsheafmkqmmpsvqistydtidnvvmdlkagridasla
svsflkpltdkpdnkdlkmfgprmtgglfgkgvgvgirkedadlkalfdkaidaaiadgt
vqklsqqwfgydasp

Timeline for d5itoa_:

• d5itoa_ is new in SCOPe 2.06-stable
  
• d5itoa_ appears in SCOPe 2.07
  
• d5itoa_ appears in the current release, SCOPe 2.08