SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5itoa_ (5ito A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145531Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2145532Protein automated matches [190039] (134 species)
    not a true protein
  7. 2145566Species Agrobacterium tumefaciens [TaxId:176299] [260526] (5 PDB entries)
  8. 2283334Domain d5itoa_: 5ito A: [326635]
    automated match to d4p0ib_
    complexed with 1pe, 6db, edo, peg, toe

Details for d5itoa_

PDB Entry: 5ito (more details), 2.35 Å

PDB Description: structure of the periplasmic binding protein m117n-noct from a. tumefaciens in complex with octopine
PDB Compounds: (A:) Nopaline-binding periplasmic protein

SCOPe Domain Sequences for d5itoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5itoa_ c.94.1.0 (A:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
dyksitiategsyapynfkdaggkligfdidlgndlckrmnieckfveqawdgiipslta
grydaimaamgiqparekviafsrpylltpntflttadspllktqvaienlpldnitpeq
kaeldkftkifegvkfgvqagtsheafmkqmmpsvqistydtidnvvmdlkagridasla
svsflkpltdkpdnkdlkmfgprmtgglfgkgvgvgirkedadlkalfdkaidaaiadgt
vqklsqqwfgydasp

SCOPe Domain Coordinates for d5itoa_:

Click to download the PDB-style file with coordinates for d5itoa_.
(The format of our PDB-style files is described here.)

Timeline for d5itoa_:

  • d5itoa_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-30