SCOPe 2.06: Domain d5ey7b_: 5ey7 B:

Lineage for d5ey7b_ (5ey7 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.0: automated matches [191321] (1 protein)
   not a true family

6. Protein automated matches [190117] (40 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:345073] [269172] (6 PDB entries)

8. Domain d5ey7b_: 5ey7 B: [326632]
   automated match to d1v1aa_
   complexed with na

Details for d5ey7b_

PDB Entry: 5ey7, 2.46 Å

PDB Description: crystal structure of fructokinase from vibrio cholerae o395 in apo form

PDB Compounds: (B:) fructokinase

SCOPe Domain Sequences for d5ey7b_:

Sequence; same for both SEQRES and ATOM records:

>d5ey7b_ c.72.1.0 (B:) automated matches {Vibrio cholerae [TaxId: 345073]}
smsrvwltgdavvdlipdgqqhylkcpggapanvavaiarlsgrsaffgrvgndpfgrfm
qqtltdeqvdcqhlhfdpvhrtstvvvdldehgersftfmvkpsadqflqlsdipsfqkg
ewlhvcsialanqpsrsstfaaiaqmkevggyvsfdpnlreevwsepqelqatvmravgl
advvkfseeelqfltgtqsieeglqaiadfqiplvvvtlgakgalvatpnsqqivsgkav
kpidttgagdafvggllyrlsvaqdwhnqatildavkwangcgalattqkg

Timeline for d5ey7b_:

• d5ey7b_ is new in SCOPe 2.06-stable
  
• d5ey7b_ appears in SCOPe 2.07
  
• d5ey7b_ appears in the current release, SCOPe 2.08