Lineage for d5fwrh_ (5fwr H:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2040316Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2040518Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2040523Family b.2.3.2: Pilus subunits [49405] (10 proteins)
  6. 2040677Protein automated matches [190569] (10 species)
    not a true protein
  7. 2040708Species Escherichia coli [TaxId:83333] [269237] (20 PDB entries)
  8. 2040741Domain d5fwrh_: 5fwr H: [326625]
    automated match to d4csta_
    complexed with 3x8; mutant

Details for d5fwrh_

PDB Entry: 5fwr (more details), 2.13 Å

PDB Description: breaking down the wall: mutation of the tyrosine gate of the universal escherichia coli fimbrial adhesin fimh
PDB Compounds: (H:) type 1 fimbiral adhesin fimh

SCOPe Domain Sequences for d5fwrh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fwrh_ b.2.3.2 (H:) automated matches {Escherichia coli [TaxId: 83333]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

SCOPe Domain Coordinates for d5fwrh_:

Click to download the PDB-style file with coordinates for d5fwrh_.
(The format of our PDB-style files is described here.)

Timeline for d5fwrh_: