Lineage for d5gpla_ (5gpl A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3010445Fold d.305: NAP-like [143112] (1 superfamily)
    core: central meander 4-stranded beta-sheet (order: 1234) transversed by a C-terminal helix
  4. 3010446Superfamily d.305.1: NAP-like [143113] (2 families) (S)
  5. 3010460Family d.305.1.0: automated matches [196445] (1 protein)
    not a true family
  6. 3010461Protein automated matches [196446] (6 species)
    not a true protein
  7. 3010492Species Schizosaccharomyces pombe [TaxId:284812] [326619] (2 PDB entries)
  8. 3010493Domain d5gpla_: 5gpl A: [326623]
    automated match to d2e50b_

Details for d5gpla_

PDB Entry: 5gpl (more details), 2.1 Å

PDB Description: crystal structure of ccp1
PDB Compounds: (A:) Putative nucleosome assembly protein C36B7.08c

SCOPe Domain Sequences for d5gpla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gpla_ d.305.1.0 (A:) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
eaaqafenlanleqefgkaeieilkkqnelfqplfeqrrdilktinnfwvvvleaagdei
sqyitpedsvllekleniyverfnekeprdvrisltfqpneylqddnltlvkevrikeek
akddeglekkitkytsqpvdihwkpgkslfrknkklppnffdyfqwtgeeedddfdgatl
tiflaedlfpnavkyfteamteeasd

SCOPe Domain Coordinates for d5gpla_:

Click to download the PDB-style file with coordinates for d5gpla_.
(The format of our PDB-style files is described here.)

Timeline for d5gpla_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5gplb_