Lineage for d5fs5a_ (5fs5 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2363595Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2363797Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2363802Family b.2.3.2: Pilus subunits [49405] (10 protein domains)
  6. 2363981Protein automated matches [190569] (9 species)
    not a true protein
  7. 2364009Species Escherichia coli [TaxId:83333] [269237] (10 PDB entries)
  8. 2364013Domain d5fs5a_: 5fs5 A: [326621]
    automated match to d4csta_
    complexed with kgm, na; mutant

Details for d5fs5a_

PDB Entry: 5fs5 (more details), 1.42 Å

PDB Description: breaking down the wall: mutation of the tyrosine gate of the universal escherichia coli fimbrial adhesin fimh
PDB Compounds: (A:) FimH

SCOPe Domain Sequences for d5fs5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fs5a_ b.2.3.2 (A:) automated matches {Escherichia coli [TaxId: 83333]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnansddfqfvwniyanndvvvpt

SCOPe Domain Coordinates for d5fs5a_:

Click to download the PDB-style file with coordinates for d5fs5a_.
(The format of our PDB-style files is described here.)

Timeline for d5fs5a_: