SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gplb_ (5gpl B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2216056Fold d.305: NAP-like [143112] (1 superfamily)
    core: central meander 4-stranded beta-sheet (order: 1234) transversed by a C-terminal helix
  4. 2216057Superfamily d.305.1: NAP-like [143113] (2 families) (S)
  5. 2216070Family d.305.1.0: automated matches [196445] (1 protein)
    not a true family
  6. 2216071Protein automated matches [196446] (3 species)
    not a true protein
  7. 2283318Species Schizosaccharomyces pombe [TaxId:284812] [326619] (2 PDB entries)
  8. 2283319Domain d5gplb_: 5gpl B: [326620]
    automated match to d2e50b_

Details for d5gplb_

PDB Entry: 5gpl (more details), 2.1 Å

PDB Description: crystal structure of ccp1
PDB Compounds: (B:) Putative nucleosome assembly protein C36B7.08c

SCOPe Domain Sequences for d5gplb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gplb_ d.305.1.0 (B:) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
eaaqafenlanleqefgkaeieilkkqnelfqplfeqrrdilktinnfwvvvleaagdei
sqyitpedsvllekleniyverfnekeprdvrisltfqpneylqddnltlvkevrikeek
akddeglekkitkytsqpvdihwkpgkslfrknkklppnffdyfqwtgeeedddfdgatl
tiflaedlfpnavkyfteamteeasd

SCOPe Domain Coordinates for d5gplb_:

Click to download the PDB-style file with coordinates for d5gplb_.
(The format of our PDB-style files is described here.)

Timeline for d5gplb_:

  • d5gplb_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-30

View in 3D
Domains from other chains:
(mouse over for more information)
d5gpla_