SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5euib_ (5eui B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976488Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 1978505Protein automated matches [190359] (42 species)
    not a true protein
  7. 2283315Species Ochotona princeps [TaxId:9978] [326616] (1 PDB entry)
  8. 2283316Domain d5euib_: 5eui B: [326617]
    Other proteins in same PDB: d5euia_
    automated match to d3lqdb_
    complexed with hem

Details for d5euib_

PDB Entry: 5eui (more details), 1.45 Å

PDB Description: structure of predicted ancestral pika hemoglobin
PDB Compounds: (B:) HBB protein

SCOPe Domain Sequences for d5euib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5euib_ a.1.1.2 (B:) automated matches {Ochotona princeps [TaxId: 9978]}
vhlsgeekaavtalwgkvnvdevggetlgrllvvypwtqrffetfgdlssasavmgnakv
kahgkkvmnafseglhhldnlkgtfaklselhcdklhvdpenfkllgnvlvvvlshhlgg
eftpqaqaawqkvvsgvanalahkyh

SCOPe Domain Coordinates for d5euib_:

Click to download the PDB-style file with coordinates for d5euib_.
(The format of our PDB-style files is described here.)

Timeline for d5euib_:

  • d5euib_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-30