SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5euia_ (5eui A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976488Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 1976759Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 2283312Species Ochotona princeps [TaxId:9978] [326613] (1 PDB entry)
  8. 2283313Domain d5euia_: 5eui A: [326614]
    Other proteins in same PDB: d5euib_
    automated match to d1irda_
    complexed with hem

Details for d5euia_

PDB Entry: 5eui (more details), 1.45 Å

PDB Description: structure of predicted ancestral pika hemoglobin
PDB Compounds: (A:) HBA protein

SCOPe Domain Sequences for d5euia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5euia_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Ochotona princeps [TaxId: 9978]}
dkanvkaawgkvgghageygaealdrmflsfpttktyfphfdmshgsaqvkahgkkvada
ltqavdhlddlpgalsalsdlhahklrvdpvnfkllahcllvtlanhhpneftpavhasl
dkflasvstvltsk

SCOPe Domain Coordinates for d5euia_:

Click to download the PDB-style file with coordinates for d5euia_.
(The format of our PDB-style files is described here.)

Timeline for d5euia_:

  • d5euia_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-30