Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (24 species) |
Species Ochotona princeps [TaxId:9978] [326613] (1 PDB entry) |
Domain d5euia_: 5eui A: [326614] Other proteins in same PDB: d5euib_ automated match to d1irda_ complexed with hem |
PDB Entry: 5eui (more details), 1.45 Å
SCOPe Domain Sequences for d5euia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5euia_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Ochotona princeps [TaxId: 9978]} dkanvkaawgkvgghageygaealdrmflsfpttktyfphfdmshgsaqvkahgkkvada ltqavdhlddlpgalsalsdlhahklrvdpvnfkllahcllvtlanhhpneftpavhasl dkflasvstvltsk
Timeline for d5euia_: