Lineage for d5euia_ (5eui A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2686238Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 2686981Species Ochotona princeps [TaxId:9978] [326613] (1 PDB entry)
  8. 2686982Domain d5euia_: 5eui A: [326614]
    Other proteins in same PDB: d5euib_
    automated match to d1irda_
    complexed with hem

Details for d5euia_

PDB Entry: 5eui (more details), 1.45 Å

PDB Description: structure of predicted ancestral pika hemoglobin
PDB Compounds: (A:) HBA protein

SCOPe Domain Sequences for d5euia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5euia_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Ochotona princeps [TaxId: 9978]}
dkanvkaawgkvgghageygaealdrmflsfpttktyfphfdmshgsaqvkahgkkvada
ltqavdhlddlpgalsalsdlhahklrvdpvnfkllahcllvtlanhhpneftpavhasl
dkflasvstvltsk

SCOPe Domain Coordinates for d5euia_:

Click to download the PDB-style file with coordinates for d5euia_.
(The format of our PDB-style files is described here.)

Timeline for d5euia_: