SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5et4c_ (5et4 C:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2155703Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2155704Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2155705Family d.5.1.1: Ribonuclease A-like [54077] (9 protein domains)
  6. 2155814Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)
  7. 2155815Species Cow (Bos taurus) [TaxId:9913] [54079] (184 PDB entries)
  8. 2283310Domain d5et4c_: 5et4 C: [326611]
    automated match to d1kf3a_
    complexed with c3p, mpd

Details for d5et4c_

PDB Entry: 5et4 (more details), 2.1 Å

PDB Description: structure of rnase a-k7h/r10h in complex with 3'-cmp
PDB Compounds: (C:) ribonuclease pancreatic

SCOPe Domain Sequences for d5et4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5et4c_ d.5.1.1 (C:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaahfehqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

SCOPe Domain Coordinates for d5et4c_:

Click to download the PDB-style file with coordinates for d5et4c_.
(The format of our PDB-style files is described here.)

Timeline for d5et4c_:

  • d5et4c_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-30