Lineage for d5eyvb_ (5eyv B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2337216Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2337217Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2337388Family a.127.1.0: automated matches [191431] (1 protein)
    not a true family
  6. 2337389Protein automated matches [190621] (24 species)
    not a true protein
  7. 2337390Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [326609] (2 PDB entries)
  8. 2337392Domain d5eyvb_: 5eyv B: [326610]
    automated match to d2vd6b_

Details for d5eyvb_

PDB Entry: 5eyv (more details), 2.14 Å

PDB Description: crystal structure of adenylosuccinate lyase from schistosoma mansoni in apo form.
PDB Compounds: (B:) adenylosuccinate lyase

SCOPe Domain Sequences for d5eyvb_:

Sequence, based on SEQRES records: (download)

>d5eyvb_ a.127.1.0 (B:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
feeyrnpltkryasremvcnfgekrkvilwrqlwiwlaetqkelgfditdeqinemksqr
dsvdfgtaaaeekarrhdvmahvytfalacpkaapiihlgatscfvgdnadlimlkdgln
illpkvarcidrlakkamlhksliclarthlqpaqpttmgrricmwiqdllldlenlerl
knhtirfrgakgavgtqasfmdlfqgdhqkvikldeiltkksgfqrswcvtgqtyprkvd
ieitnalsnigatvhkictdirllssfheveepfetkqigssampykrnpirseracsla
rylmhistsmvstvsvqwlerslddsairrivlpeaflaadacltllqniaeglivypmv
meanlnselpflvverilvkmvsegaanrqecherlrkhsheaaaeiklkglknslmdkl
lndyyfapihsllptvldpsymigraveqvevflntevdpaihsykdclalnsnit

Sequence, based on observed residues (ATOM records): (download)

>d5eyvb_ a.127.1.0 (B:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
feeyrnpltkryasremvcnfgekrkvilwrqlwiwlaetqkelgfditdeqinemksqr
dsvdfgtaaaeekarrhdvmahvytfalacpkaapiihlgatscfvgdnadlimlkdgln
illpkvarcidrlakkamlhksliclarthlqpaqpttmgrricmwiqdllldlenlerl
knhtirfrgakgavgtqasfmdlfqgdhqkvikldeiltkksgfqrswcvtgqtyprkvd
ieitnalsnigatvhkictdirllssfheveepfekrnpirseracslarylmhistsmv
stvsvqwlerslddsairrivlpeaflaadacltllqniaeglivypmvmeanlnselpf
lvverilvkmvsegaalptvldpsymigraveqvevflntevdpaihsykdclalnsnit

SCOPe Domain Coordinates for d5eyvb_:

Click to download the PDB-style file with coordinates for d5eyvb_.
(The format of our PDB-style files is described here.)

Timeline for d5eyvb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5eyva_