SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ct0a_ (5ct0 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2195690Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 protein domains)
    members organized in the groups and subfamiles specified by the comments
  6. 2197713Protein Protein kinase CK2, alpha subunit [56142] (3 species)
    CMGC group; CK2 subfamily; serine/threonine kinase
  7. 2197714Species Human (Homo sapiens) [TaxId:9606] [75559] (72 PDB entries)
  8. 2283307Domain d5ct0a_: 5ct0 A: [326608]
    automated match to d3wara_
    complexed with 54p, act

Details for d5ct0a_

PDB Entry: 5ct0 (more details), 2.01 Å

PDB Description: crystal structure of ck2alpha with 3-(3-chloro-4-(phenyl)benzylamino) propan-1-ol bound
PDB Compounds: (A:) Casein kinase II subunit alpha

SCOPe Domain Sequences for d5ct0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ct0a_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
gpvpsrarvytdvnthrpseywdyeshvvewgnqddyqlvrklgrgkysevfeainitnn
ekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdfk
qlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaefy
hpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydql
vriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfld
kllrydhqsrltareamehpyfytvv

SCOPe Domain Coordinates for d5ct0a_:

Click to download the PDB-style file with coordinates for d5ct0a_.
(The format of our PDB-style files is described here.)

Timeline for d5ct0a_:

  • d5ct0a_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-30