| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family) ![]() automatically mapped to Pfam PF02419 |
| Family f.23.31.1: PsbL-like [161018] (2 proteins) Pfam PF02419 |
| Protein Photosystem II reaction center protein L, PsbL [161019] (2 species) |
| Species Thermosynechococcus elongatus [TaxId:146786] [161020] (6 PDB entries) Uniprot Q8DIN8 1-37 |
| Domain d5kafl_: 5kaf l: [326607] Other proteins in same PDB: d5kafa_, d5kafb_, d5kafc_, d5kafd_, d5kafe_, d5kaff_, d5kafh_, d5kafi1, d5kafi2, d5kafj_, d5kafk_, d5kafm1, d5kafm2, d5kafo_, d5kaft1, d5kaft2, d5kafu_, d5kafv_, d5kafx_, d5kafz_ automated match to d2axtl1 complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl |
PDB Entry: 5kaf (more details), 3 Å
SCOPe Domain Sequences for d5kafl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kafl_ f.23.31.1 (l:) Photosystem II reaction center protein L, PsbL {Thermosynechococcus elongatus [TaxId: 146786]}
mepnpnrqpvelnrtslylglllilvlallfssyffn
Timeline for d5kafl_: