Lineage for d5kafl_ (5kaf l:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631727Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family) (S)
    automatically mapped to Pfam PF02419
  5. 2631728Family f.23.31.1: PsbL-like [161018] (2 proteins)
    Pfam PF02419
  6. 2631729Protein Photosystem II reaction center protein L, PsbL [161019] (2 species)
  7. 2631730Species Thermosynechococcus elongatus [TaxId:146786] [161020] (6 PDB entries)
    Uniprot Q8DIN8 1-37
  8. 2631735Domain d5kafl_: 5kaf l: [326607]
    Other proteins in same PDB: d5kafa_, d5kafb_, d5kafc_, d5kafd_, d5kafe_, d5kaff_, d5kafh_, d5kafi1, d5kafi2, d5kafj_, d5kafk_, d5kafm1, d5kafm2, d5kafo_, d5kaft1, d5kaft2, d5kafu_, d5kafv_, d5kafx_, d5kafz_
    automated match to d2axtl1
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kafl_

PDB Entry: 5kaf (more details), 3 Å

PDB Description: rt xfel structure of photosystem ii in the dark state at 3.0 a resolution
PDB Compounds: (l:) Photosystem II reaction center protein L

SCOPe Domain Sequences for d5kafl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kafl_ f.23.31.1 (l:) Photosystem II reaction center protein L, PsbL {Thermosynechococcus elongatus [TaxId: 146786]}
mepnpnrqpvelnrtslylglllilvlallfssyffn

SCOPe Domain Coordinates for d5kafl_:

Click to download the PDB-style file with coordinates for d5kafl_.
(The format of our PDB-style files is described here.)

Timeline for d5kafl_: