SCOPe 2.06: Domain d5kafo_: 5kaf o:

Lineage for d5kafo_ (5kaf o:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)

4. Superfamily f.4.1: OMPA-like [56925] (5 families)
   forms (8,10) barrel

5. Family f.4.1.4: PsbO-like [161115] (2 proteins)
   Pfam PF01716; MSP

6. Protein automated matches [191004] (2 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:197221] [260553] (5 PDB entries)

8. Domain d5kafo_: 5kaf o: [326606]
   Other proteins in same PDB: d5kaff_, d5kafl_, d5kafm1, d5kafm2
   automated match to d4il6o_
   complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kafo_

PDB Entry: 5kaf, 3 Å

PDB Description: rt xfel structure of photosystem ii in the dark state at 3.0 a resolution

PDB Compounds: (o:) Photosystem II manganese-stabilizing polypeptide

SCOPe Domain Sequences for d5kafo_:

Sequence; same for both SEQRES and ATOM records:

>d5kafo_ f.4.1.4 (o:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
qtltyddivgtglankcptlddtargaypidssqtyriarlclqpttflvkeepknkrqe
aefvptklvtrettsldqiqgelkvnsdgsltfveedgidfqpvtvqmaggeripllftv
knlvastqpnvtsittstdfkgefnvpsyrtanfldpkgrglasgydsaialpqakeeel
aranvkrfsltkgqislnvakvdgrtgeiagtfeseqlsdddmgahephevkiqgvfyas
iepa

Timeline for d5kafo_:

• d5kafo_ is new in SCOPe 2.06-stable
  
• d5kafo_ appears in SCOPe 2.07
  
• d5kafo_ appears in the current release, SCOPe 2.08