SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5fjtd2 (5fjt D:126-368)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2086988Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2087095Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 protein domains)
  6. 2087289Protein automated matches [226997] (13 species)
    not a true protein
  7. 2282906Species Amycolatopsis sp. [TaxId:37632] [326207] (5 PDB entries)
  8. 2283294Domain d5fjtd2: 5fjt D:126-368 [326595]
    Other proteins in same PDB: d5fjta1, d5fjtb1, d5fjtc1, d5fjtd1
    automated match to d1sjdb1
    complexed with 5cr, mg; mutant

Details for d5fjtd2

PDB Entry: 5fjt (more details), 2.11 Å

PDB Description: n-acyl amino acid racemase from amycolatopsis sp. ts-1-60: g291d f323 mutant in complex with n-acetyl phenylalanine
PDB Compounds: (D:) o-succinylbenzoate synthase

SCOPe Domain Sequences for d5fjtd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fjtd2 c.1.11.2 (D:126-368) automated matches {Amycolatopsis sp. [TaxId: 37632]}
vrdsvpcgvsvgimdtipqlldvvggyldegyvriklkiepgwdvepvravrerfgddvl
lqvdantaytlgdapqlarldpfglllieqpleeedvlghaelarriqtpicldesivsa
raaadaiklgavqivnikpgrvggylearrvhdvcaahgipvwcgdmietglgraanval
aslpnftlpgdtsasdryyktditepfvlsgghlpvptgpglgvapipelldevttakvw
igs

SCOPe Domain Coordinates for d5fjtd2:

Click to download the PDB-style file with coordinates for d5fjtd2.
(The format of our PDB-style files is described here.)

Timeline for d5fjtd2:

  • d5fjtd2 appears in periodic updates to SCOPe 2.06 starting on 2016-11-24