SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tw7e2 (5tw7 E:198-394)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2106293Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2106562Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. 2106563Protein automated matches [190116] (21 species)
    not a true protein
  7. 2283232Species Neisseria gonorrhoeae [TaxId:485] [326533] (1 PDB entry)
  8. 2283291Domain d5tw7e2: 5tw7 E:198-394 [326592]
    Other proteins in same PDB: d5tw7a1, d5tw7a3, d5tw7b1, d5tw7b3, d5tw7c1, d5tw7c3, d5tw7c4, d5tw7d1, d5tw7d3, d5tw7e1, d5tw7e3, d5tw7f1, d5tw7f3, d5tw7f4
    automated match to d1gpma1
    complexed with mg

Details for d5tw7e2

PDB Entry: 5tw7 (more details), 2.35 Å

PDB Description: crystal structure of a gmp synthase (glutamine-hydrolyzing) from neisseria gonorrhoeae
PDB Compounds: (E:) GMP synthase [glutamine-hydrolyzing]

SCOPe Domain Sequences for d5tw7e2:

Sequence, based on SEQRES records: (download)

>d5tw7e2 c.26.2.0 (E:198-394) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
wtmpnyieeavakireqvgsdevilglsggvdssvaaalihraigdqltcvfvdhgllrl
negkmvmdmfarnlgvkvihvdaegqfmaklagvtdpekkrkiigaefievfdaeekklt
nakwlaqgtiypdviesagaktkkahaikshhnvgglpenmklklleplrdlfkdevrel
gvalglpremvyrhpfp

Sequence, based on observed residues (ATOM records): (download)

>d5tw7e2 c.26.2.0 (E:198-394) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
wtmpnyieeavakireqvgsdevilglsggvdssvaaalihraigdqltcvfvdhgllrl
negkmvmdmfarnlgvkvihvdaegqfmaklagvtdpekkrkiigaefievfdaeekklt
nakwlaqgtiypdvilklleplrdlfkdevrelgvalglpremvyrhpfp

SCOPe Domain Coordinates for d5tw7e2:

Click to download the PDB-style file with coordinates for d5tw7e2.
(The format of our PDB-style files is described here.)

Timeline for d5tw7e2:

  • d5tw7e2 appears in periodic updates to SCOPe 2.06 starting on 2016-11-24