SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ts9b_ (5ts9 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011335Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. 2011336Superfamily a.130.1: Chorismate mutase II [48600] (5 families) (S)
  5. 2011396Family a.130.1.0: automated matches [237401] (1 protein)
    not a true family
  6. 2011397Protein automated matches [237402] (3 species)
    not a true protein
  7. 2283216Species Paraburkholderia phymatum [TaxId:391038] [326517] (1 PDB entry)
  8. 2283278Domain d5ts9b_: 5ts9 B: [326579]
    automated match to d4oj7a_

Details for d5ts9b_

PDB Entry: 5ts9 (more details), 1.95 Å

PDB Description: crystal structure of chorismate mutase from burkholderia phymatum
PDB Compounds: (B:) chorismate mutase

SCOPe Domain Sequences for d5ts9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ts9b_ a.130.1.0 (B:) automated matches {Paraburkholderia phymatum [TaxId: 391038]}
qdafvplvrsmadrlntadqvalskwdtgqpvydgqreaqvianaatmaseygltaedai
nifsdqveankevqyallnnwrrqgdapatprqslagvirpildklqasimqnlqsvapl
rsiadchalvasavgqvaeqasldvlhraaldravaricvk

SCOPe Domain Coordinates for d5ts9b_:

Click to download the PDB-style file with coordinates for d5ts9b_.
(The format of our PDB-style files is described here.)

Timeline for d5ts9b_:

  • d5ts9b_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-24