SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5h5nb_ (5h5n B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986230Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 1986231Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) (S)
  5. 2283118Family a.16.1.0: automated matches [326419] (1 protein)
    not a true family
  6. 2283119Protein automated matches [326420] (1 species)
    not a true protein
  7. 2283120Species Influenza a virus (a/little yellow-shouldered bat/guatemala/060/2010(h17n10)) [TaxId:1129347] [326421] (1 PDB entry)
  8. 2283277Domain d5h5nb_: 5h5n B: [326578]
    automated match to d2z0aa_

Details for d5h5nb_

PDB Entry: 5h5n (more details), 2 Å

PDB Description: the crystal structure of the ns1 (h17n10) rna-binding domain
PDB Compounds: (B:) Non-structural protein 1

SCOPe Domain Sequences for d5h5nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h5nb_ a.16.1.0 (B:) automated matches {Influenza a virus (a/little yellow-shouldered bat/guatemala/060/2010(h17n10)) [TaxId: 1129347]}
epnpttiafqvdcylwhlkktlsmmgevdapfedrlrreqkalkgrsmtlgidiqsatqe
gyykiksitee

SCOPe Domain Coordinates for d5h5nb_:

Click to download the PDB-style file with coordinates for d5h5nb_.
(The format of our PDB-style files is described here.)

Timeline for d5h5nb_:

  • d5h5nb_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-24

View in 3D
Domains from other chains:
(mouse over for more information)
d5h5na_