SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hm4b_ (5hm4 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2144293Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2145191Protein automated matches [190140] (23 species)
    not a true protein
  7. 2145352Species Thermotoga maritima [TaxId:243274] [259690] (3 PDB entries)
  8. 2283274Domain d5hm4b_: 5hm4 B: [326575]
    automated match to d4pfua_
    complexed with ca

Details for d5hm4b_

PDB Entry: 5hm4 (more details), 2 Å

PDB Description: crystal structure of oligopeptide abc transporter, periplasmic oligopeptide-binding protein (tm1226) from thermotoga maritima at 2.0 a resolution
PDB Compounds: (B:) Mannoside ABC transport system, sugar-binding protein

SCOPe Domain Sequences for d5hm4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hm4b_ c.94.1.1 (B:) automated matches {Thermotoga maritima [TaxId: 243274]}
vlernetmyyggslwsppsnwnpftpwnavpgttglvyetmffydpltgnfdpwlaekge
wldsktyrvvlregiywhdnvpltsedvrftfeiakkykgihyssvwewldhietpdnrt
vifvfkdpryhewnellytlpivpkhiweekdettilqssneyplgsgpyvahswdqnkm
iferfenwwgtkvmgvkpapkyvvivrvlsnnvalgmlmkgeldfsnfmlpgvpilkkvy
nlntwydeppyhlsstvvglflnarkyplslpefrraiamsinadpivqrvyegavlkad
plgflpnsvwmkyypkevvekhgfkydpeeaksildklgfrdvngdgfretpdgkpiklt
iecpygwtdwmqaiqvivdqlkvvginaepyfpdsskyyenmykgefdiemnangtgiss
tpwtyfntifypdalesefsytgnygryqnpeveslleelnrtpldnvekvtelcgklge
illkdlpfiplwygamafitqdnvwtnwpnehnpyawpcgwanwwqtgalkilfnlkpak

SCOPe Domain Coordinates for d5hm4b_:

Click to download the PDB-style file with coordinates for d5hm4b_.
(The format of our PDB-style files is described here.)

Timeline for d5hm4b_:

  • d5hm4b_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-24