Lineage for d5hm4b_ (5hm4 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2144293Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2145191Protein automated matches [190140] (30 species)
    not a true protein
  7. 2145352Species Thermotoga maritima [TaxId:243274] [259690] (3 PDB entries)
  8. 2283274Domain d5hm4b_: 5hm4 B: [326575]
    automated match to d4pfua_
    complexed with ca

Details for d5hm4b_

PDB Entry: 5hm4 (more details), 2 Å

PDB Description: crystal structure of oligopeptide abc transporter, periplasmic oligopeptide-binding protein (tm1226) from thermotoga maritima at 2.0 a resolution
PDB Compounds: (B:) Mannoside ABC transport system, sugar-binding protein

SCOPe Domain Sequences for d5hm4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hm4b_ c.94.1.1 (B:) automated matches {Thermotoga maritima [TaxId: 243274]}
vlernetmyyggslwsppsnwnpftpwnavpgttglvyetmffydpltgnfdpwlaekge
wldsktyrvvlregiywhdnvpltsedvrftfeiakkykgihyssvwewldhietpdnrt
vifvfkdpryhewnellytlpivpkhiweekdettilqssneyplgsgpyvahswdqnkm
iferfenwwgtkvmgvkpapkyvvivrvlsnnvalgmlmkgeldfsnfmlpgvpilkkvy
nlntwydeppyhlsstvvglflnarkyplslpefrraiamsinadpivqrvyegavlkad
plgflpnsvwmkyypkevvekhgfkydpeeaksildklgfrdvngdgfretpdgkpiklt
iecpygwtdwmqaiqvivdqlkvvginaepyfpdsskyyenmykgefdiemnangtgiss
tpwtyfntifypdalesefsytgnygryqnpeveslleelnrtpldnvekvtelcgklge
illkdlpfiplwygamafitqdnvwtnwpnehnpyawpcgwanwwqtgalkilfnlkpak

SCOPe Domain Coordinates for d5hm4b_:

Click to download the PDB-style file with coordinates for d5hm4b_.
(The format of our PDB-style files is described here.)

Timeline for d5hm4b_:

  • d5hm4b_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-24