Lineage for d5tv2a2 (5tv2 A:289-405)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2054165Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2054227Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2054536Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 2054537Protein automated matches [226946] (24 species)
    not a true protein
  7. 2283268Species Vibrio vulnificus [TaxId:216895] [326569] (1 PDB entry)
  8. 2283269Domain d5tv2a2: 5tv2 A:289-405 [326570]
    Other proteins in same PDB: d5tv2a1
    automated match to d1dara1

Details for d5tv2a2

PDB Entry: 5tv2 (more details), 1.6 Å

PDB Description: crystal structure of a fragment (1-405) of an elongation factor g from vibrio vulnificus cmcp6
PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d5tv2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tv2a2 b.43.3.0 (A:289-405) automated matches {Vibrio vulnificus [TaxId: 216895]}
pidvpaikgidendneverhaddnepfsalafkiatdpfvgtltfirvysgvvntgdavy
nsvkqkkerfgrivqmhankreeikevragdiaaaiglkdvttgdtlcnsdhkvile

SCOPe Domain Coordinates for d5tv2a2:

Click to download the PDB-style file with coordinates for d5tv2a2.
(The format of our PDB-style files is described here.)

Timeline for d5tv2a2:

  • d5tv2a2 appears in periodic updates to SCOPe 2.06 starting on 2016-11-24

View in 3D
Domains from same chain:
(mouse over for more information)
d5tv2a1