SCOPe 2.04: Domain d1aaxa_: 1aax A:

Lineage for d1aaxa_ (1aax A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein Tyrosine phosphatase [52806] (7 species)

7. Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (111 PDB entries)
   Uniprot P18031 2-300 ! Uniprot P18031 1-298 ! Uniprot P18031 2-299

8. Domain d1aaxa_: 1aax A: [32657]
   complexed with bpm, mg

Details for d1aaxa_

PDB Entry: 1aax, 1.9 Å

PDB Description: crystal structure of protein tyrosine phosphatase 1b complexed with two bis(para-phosphophenyl)methane (bppm) molecules

PDB Compounds: (A:) protein tyrosine phosphatase 1b

SCOPe Domain Sequences for d1aaxa_:

Sequence; same for both SEQRES and ATOM records:

>d1aaxa_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]}
emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
fgvpespasflnflfkvresgslspehgpvvvhssagigrsgtfcladtclllmdkrkdp
ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshed

Timeline for d1aaxa_:

• d1aaxa_ first appeared (with stable ids) in SCOP 1.55, called d1aax__
  
• d1aaxa_ appears in SCOPe 2.03
  
• d1aaxa_ appears in SCOPe 2.05
  
• d1aaxa_ appears in the current release, SCOPe 2.08