SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tv2a1 (5tv2 A:1-288)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (123 species)
    not a true protein
  7. 2283266Species Vibrio vulnificus [TaxId:216895] [326567] (1 PDB entry)
  8. 2283267Domain d5tv2a1: 5tv2 A:1-288 [326568]
    Other proteins in same PDB: d5tv2a2
    automated match to d1dara2

Details for d5tv2a1

PDB Entry: 5tv2 (more details), 1.6 Å

PDB Description: crystal structure of a fragment (1-405) of an elongation factor g from vibrio vulnificus cmcp6
PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d5tv2a1:

Sequence, based on SEQRES records: (download)

>d5tv2a1 c.37.1.0 (A:1-288) automated matches {Vibrio vulnificus [TaxId: 216895]}
marktpieryrnigicahvdagktttterilfytglshkigevhdgaatmdwmeqeqerg
ititsaatttfwrgmeaqfqdhrvniidtpghvdftieverslrvldgavvvfcgssgve
pqsetvwrqadkyhvprmvfvnkmdragadflrvvdqiknrlganpvpiqlnvgaeedfk
gvidlikmkminwneadqgmtftyeeipadmielaeewrnnlveaaaeaseelmdkylee
gelteaeikqalrartlnneivlatcgsafknkgvqavldavieylps

Sequence, based on observed residues (ATOM records): (download)

>d5tv2a1 c.37.1.0 (A:1-288) automated matches {Vibrio vulnificus [TaxId: 216895]}
marktpieryrnigicaktttterilfytglshtsaatttfwrgmeaqfqdhrvniidtp
everslrvldgavvvfcgssgvsetvwrqadkyhvprmvfvnkmdragadflrvvdqikn
rlganpvpiqlnvgaeedfkgvidlikmkminwneadqgmtftyeeipadmielaeewrn
nlveaaaeaseelmdkyleegelteaeikqalrartlnneivlatcgsafknkgvqavld
avieylps

SCOPe Domain Coordinates for d5tv2a1:

Click to download the PDB-style file with coordinates for d5tv2a1.
(The format of our PDB-style files is described here.)

Timeline for d5tv2a1:

  • d5tv2a1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-24

View in 3D
Domains from same chain:
(mouse over for more information)
d5tv2a2