Lineage for d5tv2a1 (5tv2 A:1-288)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (127 species)
    not a true protein
  7. 2283266Species Vibrio vulnificus [TaxId:216895] [326567] (1 PDB entry)
  8. 2283267Domain d5tv2a1: 5tv2 A:1-288 [326568]
    Other proteins in same PDB: d5tv2a2
    automated match to d1dara2

Details for d5tv2a1

PDB Entry: 5tv2 (more details), 1.6 Å

PDB Description: crystal structure of a fragment (1-405) of an elongation factor g from vibrio vulnificus cmcp6
PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d5tv2a1:

Sequence, based on SEQRES records: (download)

>d5tv2a1 c.37.1.0 (A:1-288) automated matches {Vibrio vulnificus [TaxId: 216895]}
marktpieryrnigicahvdagktttterilfytglshkigevhdgaatmdwmeqeqerg
ititsaatttfwrgmeaqfqdhrvniidtpghvdftieverslrvldgavvvfcgssgve
pqsetvwrqadkyhvprmvfvnkmdragadflrvvdqiknrlganpvpiqlnvgaeedfk
gvidlikmkminwneadqgmtftyeeipadmielaeewrnnlveaaaeaseelmdkylee
gelteaeikqalrartlnneivlatcgsafknkgvqavldavieylps

Sequence, based on observed residues (ATOM records): (download)

>d5tv2a1 c.37.1.0 (A:1-288) automated matches {Vibrio vulnificus [TaxId: 216895]}
marktpieryrnigicaktttterilfytglshtsaatttfwrgmeaqfqdhrvniidtp
everslrvldgavvvfcgssgvsetvwrqadkyhvprmvfvnkmdragadflrvvdqikn
rlganpvpiqlnvgaeedfkgvidlikmkminwneadqgmtftyeeipadmielaeewrn
nlveaaaeaseelmdkyleegelteaeikqalrartlnneivlatcgsafknkgvqavld
avieylps

SCOPe Domain Coordinates for d5tv2a1:

Click to download the PDB-style file with coordinates for d5tv2a1.
(The format of our PDB-style files is described here.)

Timeline for d5tv2a1:

  • d5tv2a1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-24

View in 3D
Domains from same chain:
(mouse over for more information)
d5tv2a2