SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tw7c3 (5tw7 C:395-521)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2170593Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 2170612Superfamily d.52.2: GMP synthetase C-terminal dimerisation domain [54810] (2 families) (S)
    automatically mapped to Pfam PF00958
  5. 2170629Family d.52.2.0: automated matches [227193] (1 protein)
    not a true family
  6. 2170630Protein automated matches [226919] (4 species)
    not a true protein
  7. 2283234Species Neisseria gonorrhoeae [TaxId:485] [326535] (1 PDB entry)
  8. 2283264Domain d5tw7c3: 5tw7 C:395-521 [326565]
    Other proteins in same PDB: d5tw7a1, d5tw7a2, d5tw7b1, d5tw7b2, d5tw7c1, d5tw7c2, d5tw7c4, d5tw7d1, d5tw7d2, d5tw7e1, d5tw7e2, d5tw7f1, d5tw7f2, d5tw7f4
    automated match to d1gpma3
    complexed with mg

Details for d5tw7c3

PDB Entry: 5tw7 (more details), 2.35 Å

PDB Description: crystal structure of a gmp synthase (glutamine-hydrolyzing) from neisseria gonorrhoeae
PDB Compounds: (C:) GMP synthase [glutamine-hydrolyzing]

SCOPe Domain Sequences for d5tw7c3:

Sequence, based on SEQRES records: (download)

>d5tw7c3 d.52.2.0 (C:395-521) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
gpglgvrilgevkkeyadllrqaddifiqelrnttdengtswydltsqafavflpvksvg
vmgdgrtydyvvalravitsdfmtahwaelpysllgrvsnriinevkginrvvydvsgkp
patiewe

Sequence, based on observed residues (ATOM records): (download)

>d5tw7c3 d.52.2.0 (C:395-521) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
gpglgvrilgevkkeyadllrqaddifiqelrnttdengtswydltsqafavflpvksvg
vrtydyvvalravitsdfmtahwaelpysllgrvsnriinevkginrvvydvsgkppati
ewe

SCOPe Domain Coordinates for d5tw7c3:

Click to download the PDB-style file with coordinates for d5tw7c3.
(The format of our PDB-style files is described here.)

Timeline for d5tw7c3:

  • d5tw7c3 appears in periodic updates to SCOPe 2.06 starting on 2016-11-24