SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ft6b_ (5ft6 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (111 species)
    not a true protein
  7. 2132475Species Escherichia coli K-12 [TaxId:83333] [226746] (6 PDB entries)
  8. 2283260Domain d5ft6b_: 5ft6 B: [326561]
    automated match to d4lw2a_
    complexed with gol, peg, plp

Details for d5ft6b_

PDB Entry: 5ft6 (more details), 2.05 Å

PDB Description: structure of a cysteine desulfurase from escherichia coli at 2.050 angstroem resolution
PDB Compounds: (B:) cysteine desulfurase csda

SCOPe Domain Sequences for d5ft6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ft6b_ c.67.1.0 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
nvfnpaqfraqfpalqdagvyldsaatalkpeavveatqqfyslsagnvhrsqfaeaqrl
taryeaarekvaqllnapddktivwtrgttesinmvaqcyarprlqpgdeiivsvaehha
nlvpwlmvaqqtgakvvklplnaqrlpdvdllpelitprsrilalgqmsnvtggcpdlar
aitfahsagmvvmvdgaqgavhfpadvqqldidfyafsghklygptgigvlygksellea
mspwlgggkmvhevsfdgfttqsapwkleagtpnvagviglsaalewladydinqaesws
rslatlaedalakrpgfrsfrcqdssllafdfagvhhsdmvtllaeygialragqhcaqp
llaelgvtgtlrasfapyntksdvdalvnavdralellvd

SCOPe Domain Coordinates for d5ft6b_:

Click to download the PDB-style file with coordinates for d5ft6b_.
(The format of our PDB-style files is described here.)

Timeline for d5ft6b_:

  • d5ft6b_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-24