Lineage for d5t6da1 (5t6d A:1-172)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2057856Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 protein domains)
  6. 2058054Protein automated matches [190384] (19 species)
    not a true protein
  7. 2270301Species Norwalk virus [TaxId:524364] [313606] (10 PDB entries)
  8. 2283256Domain d5t6da1: 5t6d A:1-172 [326557]
    Other proteins in same PDB: d5t6da2
    automated match to d2fyqa_
    complexed with n38

Details for d5t6da1

PDB Entry: 5t6d (more details), 2.1 Å

PDB Description: 2.10 a resolution structure of norovirus 3cl protease in complex with the dipeptidyl inhibitor 7l (hexagonal form)
PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d5t6da1:

Sequence, based on SEQRES records: (download)

>d5t6da1 b.47.1.4 (A:1-172) automated matches {Norwalk virus [TaxId: 524364]}
apptlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrf
skkmrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgm
lltganakgmdlgtipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavq

Sequence, based on observed residues (ATOM records): (download)

>d5t6da1 b.47.1.4 (A:1-172) automated matches {Norwalk virus [TaxId: 524364]}
apptlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrf
skkmrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqrlvhgqsgml
ltganakgmdlgtipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavq

SCOPe Domain Coordinates for d5t6da1:

Click to download the PDB-style file with coordinates for d5t6da1.
(The format of our PDB-style files is described here.)

Timeline for d5t6da1:

  • d5t6da1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-24

View in 3D
Domains from same chain:
(mouse over for more information)
d5t6da2
View in 3D
Domains from other chains:
(mouse over for more information)
d5t6db_