Class a: All alpha proteins [46456] (289 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) |
Family a.29.2.1: Bromodomain [47371] (5 proteins) |
Protein automated matches [190366] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187201] (61 PDB entries) |
Domain d5ep7a1: 5ep7 A:1081-1197 [326555] Other proteins in same PDB: d5ep7a2 automated match to d4nyva_ complexed with 5qr |
PDB Entry: 5ep7 (more details), 1.2 Å
SCOPe Domain Sequences for d5ep7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ep7a1 a.29.2.1 (A:1081-1197) automated matches {Human (Homo sapiens) [TaxId: 9606]} rkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikr kldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg
Timeline for d5ep7a1: