Lineage for d5hs2b_ (5hs2 B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473281Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2473282Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2474233Family c.68.1.0: automated matches [191551] (1 protein)
    not a true family
  6. 2474234Protein automated matches [190951] (26 species)
    not a true protein
  7. 2474254Species Bacillus subtilis [TaxId:224308] [321878] (3 PDB entries)
  8. 2474258Domain d5hs2b_: 5hs2 B: [326553]
    automated match to d4naka_
    complexed with ctp, mg

Details for d5hs2b_

PDB Entry: 5hs2 (more details), 1.9 Å

PDB Description: crystal structure of ispd complexed with ctp and mg2+ from bacillus subtilis at 1.90 angstroms resolution
PDB Compounds: (B:) 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase

SCOPe Domain Sequences for d5hs2b_:

Sequence, based on SEQRES records: (download)

>d5hs2b_ c.68.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 224308]}
msydvvipaagqgkrmkagrnklfielkgdpviihtlrvfdshrqcdkiilvineqereh
fqqllsdypfqtsielvaggderqhsvykglkavkqekivlvhdgarpfikheqidelia
eaeqtgaailavpvkdtikrvqdlqvsetiersslwavqtpqafrlsllmkahaeaerkg
flgtddaslveqmeggsvrvvegsytniklttpddltsaeaimese

Sequence, based on observed residues (ATOM records): (download)

>d5hs2b_ c.68.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 224308]}
msydvvipanklfielkgdpviihtlrvfdshrqcdkiilvineqerehfqqllsdypfq
tsielvaggderqhsvykglkavkqekivlvhdgarpfikheqideliaeaeqtgaaila
vpvkdtikrvqdlqvsetiersslwavqtpqafrlsllmkahaeaerkgflgtddaslve
qmeggsvrvvegsytniklttpddltsaeaimese

SCOPe Domain Coordinates for d5hs2b_:

Click to download the PDB-style file with coordinates for d5hs2b_.
(The format of our PDB-style files is described here.)

Timeline for d5hs2b_: