SCOPe 2.06: Domain d5t6fa1: 5t6f A:1-173

Lineage for d5t6fa1 (5t6f A:1-173)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein automated matches [190384] (19 species)
   not a true protein

7. Species Norwalk virus [TaxId:524364] [313606] (11 PDB entries)

8. Domain d5t6fa1: 5t6f A:1-173 [326551]
   Other proteins in same PDB: d5t6fa2, d5t6fb2
   automated match to d2fyqa_
   complexed with n38

Details for d5t6fa1

PDB Entry: 5t6f, 1.9 Å

PDB Description: 1.90 a resolution structure of norovirus 3cl protease in complex with the dipeptidyl inhibitor 7l (orthorhombic p form)

PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d5t6fa1:

Sequence, based on SEQRES records:

>d5t6fa1 b.47.1.4 (A:1-173) automated matches {Norwalk virus [TaxId: 524364]}
apptlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrf
skkmrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgm
lltganakgmdlgtipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavqa

Sequence, based on observed residues (ATOM records):

>d5t6fa1 b.47.1.4 (A:1-173) automated matches {Norwalk virus [TaxId: 524364]}
apptlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrf
skkmrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgm
lllgtipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavqa

Timeline for d5t6fa1:

• d5t6fa1 is new in SCOPe 2.06-stable
  
• d5t6fa1 appears in SCOPe 2.07
  
• d5t6fa1 appears in the current release, SCOPe 2.08