Lineage for d5tmfc_ (5tmf C:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2222928Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 2222929Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 2222930Family e.29.1.1: RNA-polymerase beta [64485] (3 protein domains)
  6. 2222983Protein automated matches [190192] (4 species)
    not a true protein
  7. 2223001Species Thermus thermophilus [TaxId:274] [186932] (8 PDB entries)
  8. 2283245Domain d5tmfc_: 5tmf C: [326546]
    Other proteins in same PDB: d5tmfd_, d5tmfe_, d5tmff1, d5tmff2, d5tmff3
    automated match to d4g7hc_
    complexed with mg, ne6, po4, zn

Details for d5tmfc_

PDB Entry: 5tmf (more details), 3 Å

PDB Description: re-refinement of thermus thermophilus rna polymerase
PDB Compounds: (C:) DNA-directed RNA polymerase subunit beta

SCOPe Domain Sequences for d5tmfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tmfc_ e.29.1.1 (C:) automated matches {Thermus thermophilus [TaxId: 274]}
meikrfgrireviplpplteiqvesyrralqadvppekrenvgiqaafretfpieeedkg
kgglvldfleyrlgeppfpqdecrekdltyqaplyarlqlihkdtglikedevflghipl
mtedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidlevepng
vvsmkvnkrkfplvlllrvlgydqetlarelgaygelvqglmdesvfamrpeealirlft
llrpgdppkrdkavayvygliadprrydlgeagrykaeeklgirlsgrtlarfedgefkd
evflptlrylfaltagvpghevddidhlgnrrirtvgelmtdqfrvglarlargvrerml
mgsedsltpaklvnsrpleaaireffsrsqlsqfkdetnplsslrhkrrisalgpggltr
eragfdvrdvhrthygricpvetpeganiglitslaayarvdelgfirtpyrrvvggvvt
devvymtateedrytiaqantplegnriaaervvarrkgepvivspeevefmdvspkqvf
svntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeed
gevakvdgnrivvryedgrlveyplrrfyrsnqgtaldqrprvvvgqrvrkgdlladgpa
sengflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgpe
ritrdiphlseaalrdldeegvvrigaevkpgdilvgrtsfkgeseptpeerllrsifge
kardvkdtslrvppgeggivvrtvrlrrgdpgvelkpgvrevvrvyvaqkrklqvgdkla
nrhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqr
yispifdgakepeikellaqafevyfgkrkgegfgvdkrevevlrraeklglvtpgktpe
eqlkelflqgkvvlydgrtgepiegpivvgqmfimklyhmvedkmharstgpyslitqqp
lggkaqfggqrfgemevwaleaygaahtlqemltlksddiegrnaayeaiikgedvpeps
vpesfrvlvkelqalaldvqtldekdnpvdifeglaskr

SCOPe Domain Coordinates for d5tmfc_:

Click to download the PDB-style file with coordinates for d5tmfc_.
(The format of our PDB-style files is described here.)

Timeline for d5tmfc_:

  • d5tmfc_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-24