SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tw7a1 (5tw7 A:3-197)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2104318Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2104743Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 2104744Protein automated matches [190197] (20 species)
    not a true protein
  7. 2283230Species Neisseria gonorrhoeae [TaxId:485] [326531] (1 PDB entry)
  8. 2283241Domain d5tw7a1: 5tw7 A:3-197 [326542]
    Other proteins in same PDB: d5tw7a2, d5tw7a3, d5tw7b2, d5tw7b3, d5tw7c2, d5tw7c3, d5tw7c4, d5tw7d2, d5tw7d3, d5tw7e2, d5tw7e3, d5tw7f2, d5tw7f3, d5tw7f4
    automated match to d1gpma2
    complexed with mg

Details for d5tw7a1

PDB Entry: 5tw7 (more details), 2.35 Å

PDB Description: crystal structure of a gmp synthase (glutamine-hydrolyzing) from neisseria gonorrhoeae
PDB Compounds: (A:) GMP synthase [glutamine-hydrolyzing]

SCOPe Domain Sequences for d5tw7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tw7a1 c.23.16.0 (A:3-197) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
qdkilildfgsqvtrliarrvreahvycelhsfdmpldeikafnpkgiilsggpnsvyes
dyqadtgifdlgipvlgicygmqfmahhlggevqpgnqrefgyaqvktidsgltrgiqdd
apntldvwmshgdkvsklpdgfavigdtpscpiammentekqfygiqfhpevthtkqgra
llnrfvldicgaqpg

SCOPe Domain Coordinates for d5tw7a1:

Click to download the PDB-style file with coordinates for d5tw7a1.
(The format of our PDB-style files is described here.)

Timeline for d5tw7a1:

  • d5tw7a1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-24