SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tola_ (5tol A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2060177Family b.50.1.2: Pepsin-like [50646] (11 protein domains)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2060235Protein beta-secretase (memapsin) [50671] (1 species)
  7. 2060236Species Human (Homo sapiens) [TaxId:9606] [50672] (281 PDB entries)
    Uniprot P56817 58-446 ! Uniprot P56817 60-447
  8. 2283236Domain d5tola_: 5tol A: [326537]
    automated match to d3kmxa_
    complexed with 7h3

Details for d5tola_

PDB Entry: 5tol (more details), 2.51 Å

PDB Description: crystal structure of beta-site app-cleaving enzyme 1 complexed with n- (3-((4as,7as)-2-amino-4,4a,5,6-tetrahydro-7ah-furo[2,3-d][1, 3]thiazin-7a-yl)-4-fluorophenyl)-5-bromo-2-pyridinecarboxamide
PDB Compounds: (A:) Beta-secretase 1

SCOPe Domain Sequences for d5tola_:

Sequence, based on SEQRES records: (download)

>d5tola_ b.50.1.2 (A:) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
gsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrql
sstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwe
gilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmii
ggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrl
pkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsf
ritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfav
sachvhdefrtaavegpfvtldmedcgyn

Sequence, based on observed residues (ATOM records): (download)

>d5tola_ b.50.1.2 (A:) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
gsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrql
sstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwe
gilglayaeiarpddslepffdslvkqthvpnlfslqlcgsvggsmiiggidhslytgsl
wytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpkkvfeaavksi
kaasstekfpdgfwlgeqlvcwqattpwnifpvislylmgevtnqsfritilpqqylrpv
edvatsdcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsachvhdefrtaave
gpfvtldmedcgyn

SCOPe Domain Coordinates for d5tola_:

Click to download the PDB-style file with coordinates for d5tola_.
(The format of our PDB-style files is described here.)

Timeline for d5tola_:

  • d5tola_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-24