![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
![]() | Family c.1.11.1: Enolase [51605] (2 proteins) automatically mapped to Pfam PF00113 |
![]() | Protein Enolase [51606] (11 species) Fold of this protein slightly differs from common fold in topology |
![]() | Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110371] (15 PDB entries) Uniprot P09104 |
![]() | Domain d5eu9h2: 5eu9 H:141-434 [326527] Other proteins in same PDB: d5eu9a1, d5eu9b1, d5eu9c1, d5eu9c3, d5eu9d1, d5eu9e1, d5eu9f1, d5eu9f3, d5eu9g1, d5eu9h1 automated match to d2akza1 complexed with 5tx, mg, pge |
PDB Entry: 5eu9 (more details), 2.05 Å
SCOPe Domain Sequences for d5eu9h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5eu9h2 c.1.11.1 (H:141-434) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]} sdlilpvpafnvinggshagnklamqefmilpvgaesfrdamrlgaevyhtlkgvikdky gkdatnvgdeggfapnilensealelvkeaidkagytekivigmdvaasefyrdgkydld fksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddwaawskftanvgiqivgddl tvtnpkrieraveekacnclllkvnqigsvteaiqacklaqengwgvmvshrsgetedtf iadlvvglctgqiktgapcrserlakynqlmrieeelgdearfaghnfrnpsvl
Timeline for d5eu9h2: