SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5eu9g1 (5eu9 G:2-140)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2170927Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2170928Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2170929Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 protein domains)
    C-terminal domain is beta/alpha-barrel
  6. 2170980Protein Enolase [54828] (10 species)
  7. 2171024Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110936] (13 PDB entries)
    Uniprot P09104
  8. 2283221Domain d5eu9g1: 5eu9 G:2-140 [326522]
    Other proteins in same PDB: d5eu9a2, d5eu9b2, d5eu9c2, d5eu9c3, d5eu9d2, d5eu9e2, d5eu9f2, d5eu9f3, d5eu9g2, d5eu9h2
    automated match to d2akza2
    complexed with 5tx, mg, pge

Details for d5eu9g1

PDB Entry: 5eu9 (more details), 2.05 Å

PDB Description: structure of human enolase 2 in complex with ((3s,5s)-1,5-dihydroxy-3- methyl-2-oxopyrrolidin-3-yl)phosphonic acid
PDB Compounds: (G:) Gamma-enolase

SCOPe Domain Sequences for d5eu9g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5eu9g1 d.54.1.1 (G:2-140) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
gaaerelplyrhiaqlagn

SCOPe Domain Coordinates for d5eu9g1:

Click to download the PDB-style file with coordinates for d5eu9g1.
(The format of our PDB-style files is described here.)

Timeline for d5eu9g1:

  • d5eu9g1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-24