Lineage for d5tmfe_ (5tmf E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2013114Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 2013115Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 2013116Family a.143.1.1: RNA polymerase omega subunit [63563] (2 protein domains)
    4 helices; irregular array
  6. 2013156Protein automated matches [257263] (2 species)
    not a true protein
  7. 2283211Species Thermus thermophilus [TaxId:274] [326512] (1 PDB entry)
  8. 2283212Domain d5tmfe_: 5tmf E: [326513]
    Other proteins in same PDB: d5tmfc_, d5tmfd_, d5tmff1, d5tmff2, d5tmff3
    automated match to d1i6ve_
    complexed with mg, ne6, po4, zn

Details for d5tmfe_

PDB Entry: 5tmf (more details), 3 Å

PDB Description: re-refinement of thermus thermophilus rna polymerase
PDB Compounds: (E:) DNA-directed RNA polymerase subunit omega

SCOPe Domain Sequences for d5tmfe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tmfe_ a.143.1.1 (E:) automated matches {Thermus thermophilus [TaxId: 274]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnae
twamkelltgrlvfgenlvpedrlqkemeriypge

SCOPe Domain Coordinates for d5tmfe_:

Click to download the PDB-style file with coordinates for d5tmfe_.
(The format of our PDB-style files is described here.)

Timeline for d5tmfe_:

  • d5tmfe_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-24