SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tmfe_ (5tmf E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2013114Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 2013115Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 2013116Family a.143.1.1: RNA polymerase omega subunit [63563] (2 protein domains)
    4 helices; irregular array
  6. 2013156Protein automated matches [257263] (2 species)
    not a true protein
  7. 2283211Species Thermus thermophilus [TaxId:274] [326512] (1 PDB entry)
  8. 2283212Domain d5tmfe_: 5tmf E: [326513]
    Other proteins in same PDB: d5tmfc_, d5tmfd_, d5tmff1, d5tmff2, d5tmff3
    automated match to d1i6ve_
    complexed with mg, ne6, po4, zn

Details for d5tmfe_

PDB Entry: 5tmf (more details), 3 Å

PDB Description: re-refinement of thermus thermophilus rna polymerase
PDB Compounds: (E:) DNA-directed RNA polymerase subunit omega

SCOPe Domain Sequences for d5tmfe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tmfe_ a.143.1.1 (E:) automated matches {Thermus thermophilus [TaxId: 274]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnae
twamkelltgrlvfgenlvpedrlqkemeriypge

SCOPe Domain Coordinates for d5tmfe_:

Click to download the PDB-style file with coordinates for d5tmfe_.
(The format of our PDB-style files is described here.)

Timeline for d5tmfe_:

  • d5tmfe_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-24