Lineage for d5tmff2 (5tmf F:258-318)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1985191Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) (S)
  5. 1985292Family a.4.13.0: automated matches [254211] (1 protein)
    not a true family
  6. 1985293Protein automated matches [254475] (3 species)
    not a true protein
  7. Species Thermus thermophilus [TaxId:274] [255021] (2 PDB entries)
  8. 1985308Domain d5tmff2: 5tmf F:258-318 [326510]
    Other proteins in same PDB: d5tmfc_, d5tmfd_, d5tmfe_, d5tmff1
    automated match to d1smyf1
    complexed with mg, ne6, po4, zn

Details for d5tmff2

PDB Entry: 5tmf (more details), 3 Å

PDB Description: re-refinement of thermus thermophilus rna polymerase
PDB Compounds: (F:) RNA polymerase sigma factor SigA

SCOPe Domain Sequences for d5tmff2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tmff2 a.4.13.0 (F:258-318) automated matches {Thermus thermophilus [TaxId: 274]}
iripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvsl
e

SCOPe Domain Coordinates for d5tmff2:

Click to download the PDB-style file with coordinates for d5tmff2.
(The format of our PDB-style files is described here.)

Timeline for d5tmff2: