SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tmff2 (5tmf F:258-318)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1984585Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) (S)
  5. 1984684Family a.4.13.0: automated matches [254211] (1 protein)
    not a true family
  6. 1984685Protein automated matches [254475] (3 species)
    not a true protein
  7. Species Thermus thermophilus [TaxId:274] [255021] (2 PDB entries)
  8. 2283209Domain d5tmff2: 5tmf F:258-318 [326510]
    Other proteins in same PDB: d5tmfc_, d5tmfd_, d5tmfe_, d5tmff1
    automated match to d1smyf1
    complexed with mg, ne6, po4, zn

Details for d5tmff2

PDB Entry: 5tmf (more details), 3 Å

PDB Description: re-refinement of thermus thermophilus rna polymerase
PDB Compounds: (F:) RNA polymerase sigma factor SigA

SCOPe Domain Sequences for d5tmff2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tmff2 a.4.13.0 (F:258-318) automated matches {Thermus thermophilus [TaxId: 274]}
iripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvsl
e

SCOPe Domain Coordinates for d5tmff2:

Click to download the PDB-style file with coordinates for d5tmff2.
(The format of our PDB-style files is described here.)

Timeline for d5tmff2:

  • d5tmff2 appears in periodic updates to SCOPe 2.06 starting on 2016-11-24