SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tmff1 (5tmf F:73-257)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014239Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily)
    multihelical; consists of a conserved 4-helical core and a variable insert subdomain
  4. 2014240Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (2 families) (S)
  5. 2014241Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (6 protein domains)
  6. 2014283Protein automated matches [254474] (3 species)
    not a true protein
  7. Species Thermus thermophilus [TaxId:274] [255020] (2 PDB entries)
  8. 2283208Domain d5tmff1: 5tmf F:73-257 [326509]
    Other proteins in same PDB: d5tmfc_, d5tmfd_, d5tmfe_, d5tmff2, d5tmff3
    automated match to d1smyf3
    complexed with mg, ne6, po4, zn

Details for d5tmff1

PDB Entry: 5tmf (more details), 3 Å

PDB Description: re-refinement of thermus thermophilus rna polymerase
PDB Compounds: (F:) RNA polymerase sigma factor SigA

SCOPe Domain Sequences for d5tmff1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tmff1 a.177.1.1 (F:73-257) automated matches {Thermus thermophilus [TaxId: 274]}
pkistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvr
akilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanl
rlvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraia
dqart

SCOPe Domain Coordinates for d5tmff1:

Click to download the PDB-style file with coordinates for d5tmff1.
(The format of our PDB-style files is described here.)

Timeline for d5tmff1:

  • d5tmff1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-24