Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.224: SufE/NifU [82648] (1 superfamily) alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123 |
Superfamily d.224.1: SufE/NifU [82649] (4 families) iron-sulfur cluster assembly proteins |
Family d.224.1.1: SufE-like [82650] (3 proteins) Fe-S metabolism associated domain automatically mapped to Pfam PF02657 |
Protein automated matches [191012] (4 species) not a true protein |
Species Escherichia coli [TaxId:83333] [326403] (1 PDB entry) |
Domain d5ft8l_: 5ft8 L: [326503] Other proteins in same PDB: d5ft8a_, d5ft8b2, d5ft8c_, d5ft8d2, d5ft8e_, d5ft8g_, d5ft8h2, d5ft8i_, d5ft8k_, d5ft8m_, d5ft8o_ automated match to d4lw4c_ complexed with css, gol, peg, plp |
PDB Entry: 5ft8 (more details), 2.5 Å
SCOPe Domain Sequences for d5ft8l_:
Sequence, based on SEQRES records: (download)
>d5ft8l_ d.224.1.1 (L:) automated matches {Escherichia coli [TaxId: 83333]} ghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiagcenrvwl gytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelglraqlsa srsqglnalseaiiaatkqv
>d5ft8l_ d.224.1.1 (L:) automated matches {Escherichia coli [TaxId: 83333]} ghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiagenrvwlg ytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelglraqlsas rsqglnalseaiiaatkqv
Timeline for d5ft8l_: