SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ft8l_ (5ft8 L:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2213792Fold d.224: SufE/NifU [82648] (1 superfamily)
    alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123
  4. 2213793Superfamily d.224.1: SufE/NifU [82649] (4 families) (S)
    iron-sulfur cluster assembly proteins
  5. 2213794Family d.224.1.1: SufE-like [82650] (3 protein domains)
    Fe-S metabolism associated domain
    automatically mapped to Pfam PF02657
  6. 2213802Protein automated matches [191012] (4 species)
    not a true protein
  7. 2283102Species Escherichia coli [TaxId:83333] [326403] (1 PDB entry)
  8. 2283202Domain d5ft8l_: 5ft8 L: [326503]
    Other proteins in same PDB: d5ft8a_, d5ft8b2, d5ft8c_, d5ft8d2, d5ft8e_, d5ft8g_, d5ft8h2, d5ft8i_, d5ft8k_, d5ft8m_, d5ft8o_
    automated match to d4lw4c_
    complexed with css, gol, peg, plp

Details for d5ft8l_

PDB Entry: 5ft8 (more details), 2.5 Å

PDB Description: structure of a cysteine desulfurase-sulfur acceptor complex from escherichia coli at 2.50 angstroem resolution
PDB Compounds: (L:) sulfur acceptor protein csde

SCOPe Domain Sequences for d5ft8l_:

Sequence, based on SEQRES records: (download)

>d5ft8l_ d.224.1.1 (L:) automated matches {Escherichia coli [TaxId: 83333]}
ghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiagcenrvwl
gytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelglraqlsa
srsqglnalseaiiaatkqv

Sequence, based on observed residues (ATOM records): (download)

>d5ft8l_ d.224.1.1 (L:) automated matches {Escherichia coli [TaxId: 83333]}
ghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiagenrvwlg
ytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelglraqlsas
rsqglnalseaiiaatkqv

SCOPe Domain Coordinates for d5ft8l_:

Click to download the PDB-style file with coordinates for d5ft8l_.
(The format of our PDB-style files is described here.)

Timeline for d5ft8l_:

  • d5ft8l_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-24